PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_46D39C394.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 281aa    MW: 30890.9 Da    PI: 5.1983
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_46D39C394.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-151461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++lv      G  +W+++++  g+ R++k+c++rw +yl
  Traes_5DL_46D39C394.1 14 KGPWTAEEDQKLVSFLLSNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                           79******************************99************97 PP

2Myb_DNA-binding56.56.6e-1870111447
                            S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             + eE++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Traes_5DL_46D39C394.1  70 LSDEEEKTVIDLHEQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                            589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-19562IPR009057Homeodomain-like
PROSITE profilePS5129414.172961IPR017930Myb domain
SuperFamilySSF466891.09E-2611108IPR009057Homeodomain-like
SMARTSM007171.3E-111363IPR001005SANT/Myb domain
PfamPF002498.4E-141461IPR001005SANT/Myb domain
CDDcd001671.10E-81661No hitNo description
PROSITE profilePS5129427.06962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2563116IPR009057Homeodomain-like
SMARTSM007175.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1570111IPR001005SANT/Myb domain
CDDcd001675.72E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLL SNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDEEEKTVID LHEQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPATHKPLQ PAAAATHQQP QRPTGGDSPE QKVPAAAATG SQSGAEEDMF CPDEVPTMMQ  180
LLDNIILPCD VVEPAPLDSS CGTASSPAES SSSSSSASAA SSGGGFEDDW LPKIMEWPVE  240
PMFMMGLDVD VVTGPTSAWE FEDAFNAYQR ISLFDHQETW A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3752630.0AK375263.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3089G21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578088.11e-133PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-85ODO1_PETHY; Protein ODORANT1
TrEMBLR7WGC70.0R7WGC7_AEGTA; Protein ODORANT1
TrEMBLW5FSV00.0W5FSV0_WHEAT; Uncharacterized protein
STRINGMLOC_50944.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-86myb domain protein 20
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]